PTM Viewer PTM Viewer

AT4G25200.1

Arabidopsis thaliana [ath]

mitochondrion-localized small heat shock protein 23.6

No PTMs currently found

PLAZA: AT4G25200
Gene Family: HOM05D001099
Other Names: ATHSP23.6-MITO; HSP23.6-MITO

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 210

MASALALKRLLSSSIAPRSRSVLRPAVSSRLFNTNAVRSYDDDGENGDGVDLYRRSVPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEIN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002068 100 210
Molecule Processing
Show Type From To
Transit Peptide 1 31

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here